PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00276.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 302aa    MW: 34968.4 Da    PI: 7.8779
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00276.1_g00022.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51131371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp+GfrFhPtd+elv++yL++k++g+++++ ++i+e+d+yk++Pw+Lp+k+  +ekewyfFs+rd+ky++g+r+nra+ +gyWkat
  Sme2.5_00276.1_g00022.1  13 LPAGFRFHPTDDELVQHYLCRKCAGQSISV-SIIAEIDLYKFDPWQLPEKALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKAT 97 
                              799***************************.89***************8777889******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk+v +   ++ g+kk Lvfy g+ap+g kt+W+mheyrl
  Sme2.5_00276.1_g00022.1  98 GADKPVGK--PRTLGIKKALVFYAGKAPRGIKTNWIMHEYRL 137
                              ******98..7789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-618163IPR003441NAC domain
PROSITE profilePS5100559.26113163IPR003441NAC domain
PfamPF023655.5E-2714137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MIRGVAGNQQ LELPAGFRFH PTDDELVQHY LCRKCAGQSI SVSIIAEIDL YKFDPWQLPE  60
KALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPVGKPRTLG IKKALVFYAG  120
KAPRGIKTNW IMHEYRLANV DRSAGKNNNL RLDEWVLCRI YNKKGTLEKY YNVDNKDNAS  180
FEDFDEEIKP KNLPTQLPPG PMPPRPRSTP TNDYFHFETS ESMTRMHTTN SSSGSEHVLS  240
PCDKEVQSAP KWDDYGNILD FQIKYLDGLL NDPFETQMQQ QNCNFDQFNN FQDMFLYMQK  300
PY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-8511693174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6688130.0KF668813.1 Solanum melongena NAC1 transcription factor (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305595.10.0NAC domain-containing protein 2
SwissprotQ390131e-118NAC2_ARATH; NAC domain-containing protein 2
TrEMBLV5TG050.0V5TG05_SOLME; NAC1 transcription factor
STRINGSolyc04g009440.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-110NAC family protein